PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G05090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 266aa    MW: 29441.1 Da    PI: 8.0803
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G05090.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like971.4e-3081134155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  AT5G05090.1  81 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 134
                  59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.05978137IPR017930Myb domain
SuperFamilySSF466892.33E-2078138IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.4E-3180139IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-2482134IPR006447Myb domain, plants
PfamPF002499.4E-884133IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MREEDSNWFA KWEEELPSPE ELIPLSQSLI TPDLAIAFDL HRNNNSNSGQ PLPQTTPPQP  60
NSSAEIAGDS TGDEPARTLK RPRLVWTPQL HKRFVDAVAH LGIKNAVPKT IMQLMSVDGL  120
TRENVASHLQ KYRLYLKRMK SGGGGGGSGD SDHLFASSPV PPHFLHPTSR QSSDLFIPSF  180
VPISTQQQHI AAPPSQFLHR QISAVNFTSP TKATDQAMFL ARQQSELQQP VFKPSSLHLH  240
SQVANYTQDL KSGAKTVLTL FPTRDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-2180139463ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.330340.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306807900.0
Genevisible250810_at0.0
Expression AtlasAT5G05090-
AtGenExpressAT5G05090-
ATTED-IIAT5G05090-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00056PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G05090.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G05090
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0052450.0AB005245.2 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MUG13.
GenBankAY0931880.0AY093188.1 Arabidopsis thaliana unknown protein (At5g05090) mRNA, complete cds.
GenBankBT0062890.0BT006289.1 Arabidopsis thaliana At5g05090 mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196128.10.0homeodomain-like superfamily protein
SwissprotQ9SNB48e-47PCL1_ARATH; Transcription factor LUX
TrEMBLQ9FF650.0Q9FF65_ARATH; At5g05090
STRINGAT5G05090.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15492791
Representative plantOGRP11571753
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Hazen SP, et al.
    LUX ARRHYTHMO encodes a Myb domain protein essential for circadian rhythms.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(29): p. 10387-92
    [PMID:16006522]
  3. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]